PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 1300010135
Common NameOt13g01350, OT_ostta13g01310
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; prasinophytes; Mamiellophyceae; Mamiellales; Bathycoccaceae; Ostreococcus
Family WOX
Protein Properties Length: 204aa    MW: 22309 Da    PI: 10.0317
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
1300010135genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox53.83.2e-17134195157
                 TT--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
    Homeobox   1 rrkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                 r +R+t t++q e+Le+lF+k ++ p +++ +eL++ l     ++e++V++WFqNrR +ekk
  1300010135 134 RGPRWTGTPTQYEILEDLFQKgEQPPVRDRLTELTEMLkqhgPVQESNVYNWFQNRRSREKK 195
                 569*****************99999*************99999******************8 PP

2Wus_type_Homeobox75.11.1e-24136195463
  Wus_type_Homeobox   4 tRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerq 63 
                        +RWt tp+Q +iLe+l+++G + P +++++++t++L+++G +++ NV++WFQNr++Re++
         1300010135 136 PRWTGTPTQYEILEDLFQKGEQPPVRDRLTELTEMLKQHGPVQESNVYNWFQNRRSREKK 195
                        7*********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-14113195IPR009057Homeodomain-like
SuperFamilySSF466896.42E-17130201IPR009057Homeodomain-like
PROSITE profilePS5007113.685131196IPR001356Homeobox domain
SMARTSM003893.1E-9133200IPR001356Homeobox domain
CDDcd000861.96E-9134197No hitNo description
PfamPF000468.8E-15134195IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001944Biological Processvasculature development
GO:0010072Biological Processprimary shoot apical meristem specification
GO:0051301Biological Processcell division
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 204 aa     Download sequence    Send to blast
MGSSDARTDD ANGLESGKSA VERRAAMVHA AKATLPGDVR APPPGAAVHM TERQLYAFRQ  60
QIAAYAHICQ QLLQITTVSA TQQTPRQREM RHEVPGATGA NWGASVPVTA PASAPLSSSN  120
HSSGKTRGED KQARGPRWTG TPTQYEILED LFQKGEQPPV RDRLTELTEM LKQHGPVQES  180
NVYNWFQNRR SREKKLQAMA MGH*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003082606.11e-151HB2 homeodomain protein (ISS)
TrEMBLQ00X481e-151Q00X48_
STRINGQ00X481e-150(Ostreococcus tauri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP644567
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20700.15e-21WUSCHEL related homeobox 14
Publications ? help Back to Top
  1. Derelle E, et al.
    Genome analysis of the smallest free-living eukaryote Ostreococcus tauri unveils many unique features.
    Proc. Natl. Acad. Sci. U.S.A., 2006. 103(31): p. 11647-52
    [PMID:16868079]